SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l0na_ (5l0n A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2071306Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2071539Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2071540Protein automated matches [226927] (14 species)
    not a true protein
  7. 2071560Species Human (Homo sapiens) [TaxId:9606] [256346] (12 PDB entries)
  8. 2293869Domain d5l0na_: 5l0n A: [337170]
    automated match to d4ku7a_
    complexed with 6za, ca, edo, so4

Details for d5l0na_

PDB Entry: 5l0n (more details), 1.29 Å

PDB Description: pkg i's carboxyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with rp-cgmp
PDB Compounds: (A:) cGMP-dependent protein kinase 1

SCOPe Domain Sequences for d5l0na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l0na_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiiskg
tvnvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhl
igglddv

SCOPe Domain Coordinates for d5l0na_:

Click to download the PDB-style file with coordinates for d5l0na_.
(The format of our PDB-style files is described here.)

Timeline for d5l0na_:

  • d5l0na_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03