Lineage for d5l0na_ (5l0n A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2071306Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2071539Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2071540Protein automated matches [226927] (14 species)
    not a true protein
  7. 2071560Species Human (Homo sapiens) [TaxId:9606] [256346] (13 PDB entries)
  8. 2293869Domain d5l0na_: 5l0n A: [337170]
    automated match to d4ku7a_
    complexed with 6za, ca, edo, so4

Details for d5l0na_

PDB Entry: 5l0n (more details), 1.29 Å

PDB Description: pkg i's carboxyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with rp-cgmp
PDB Compounds: (A:) cGMP-dependent protein kinase 1

SCOPe Domain Sequences for d5l0na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l0na_ b.82.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glikhteymeflksvptfqslpeeilskladvleethyengeyiirqgargdtffiiskg
tvnvtredspsedpvflrtlgkgdwfgekalqgedvrtanviaaeavtclvidrdsfkhl
igglddv

SCOPe Domain Coordinates for d5l0na_:

Click to download the PDB-style file with coordinates for d5l0na_.
(The format of our PDB-style files is described here.)

Timeline for d5l0na_:

  • d5l0na_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03