Lineage for d1clqa1 (1clq A:1-375)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124495Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
  5. 124680Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)
  6. 124681Protein Exonuclease domain of family B (archaeal and phage) DNA polymerases [53125] (6 species)
  7. 124691Species Bacteriophage RB69 [TaxId:12353] [53127] (5 PDB entries)
  8. 124694Domain d1clqa1: 1clq A:1-375 [33717]
    Other proteins in same PDB: d1clqa2

Details for d1clqa1

PDB Entry: 1clq (more details), 2.7 Å

PDB Description: crystal structure of a replication fork dna polymerase editing complex at 2.7 a resolution

SCOP Domain Sequences for d1clqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clqa1 c.55.3.5 (A:1-375) Exonuclease domain of family B (archaeal and phage) DNA polymerases {Bacteriophage RB69}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfdipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniidvyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

SCOP Domain Coordinates for d1clqa1:

Click to download the PDB-style file with coordinates for d1clqa1.
(The format of our PDB-style files is described here.)

Timeline for d1clqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1clqa2