Lineage for d5k9ba_ (5k9b A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856358Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 2856472Protein automated matches [190443] (6 species)
    not a true protein
  7. 2856485Species Azotobacter vinelandii [TaxId:354] [337168] (1 PDB entry)
  8. 2856486Domain d5k9ba_: 5k9b A: [337169]
    automated match to d2wc1a_
    complexed with fmn, mg

Details for d5k9ba_

PDB Entry: 5k9b (more details), 1.17 Å

PDB Description: azotobacter vinelandii flavodoxin ii
PDB Compounds: (A:) Flavodoxin-2

SCOPe Domain Sequences for d5k9ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k9ba_ c.23.5.1 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]}
akiglffgsntgktrkvaksikkrfddetmsdalnvnrvsaedfaqyqflilgtptlgeg
elpglssdcenesweeflpkiegldfsgktvalfglgdqvgypenyldalgelysffkdr
gakivgswstdgyefesseavvdgkfvglaldldnqsgktdervaawlaqiapefglsl

SCOPe Domain Coordinates for d5k9ba_:

Click to download the PDB-style file with coordinates for d5k9ba_.
(The format of our PDB-style files is described here.)

Timeline for d5k9ba_: