SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k9ba_ (5k9b A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102351Family c.23.5.1: Flavodoxin-related [52219] (6 protein domains)
    binds FMN
  6. 2102463Protein automated matches [190443] (6 species)
    not a true protein
  7. 2293867Species Azotobacter vinelandii [TaxId:354] [337168] (1 PDB entry)
  8. 2293868Domain d5k9ba_: 5k9b A: [337169]
    automated match to d2wc1a_
    complexed with fmn, mg

Details for d5k9ba_

PDB Entry: 5k9b (more details), 1.17 Å

PDB Description: azotobacter vinelandii flavodoxin ii
PDB Compounds: (A:) Flavodoxin-2

SCOPe Domain Sequences for d5k9ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k9ba_ c.23.5.1 (A:) automated matches {Azotobacter vinelandii [TaxId: 354]}
akiglffgsntgktrkvaksikkrfddetmsdalnvnrvsaedfaqyqflilgtptlgeg
elpglssdcenesweeflpkiegldfsgktvalfglgdqvgypenyldalgelysffkdr
gakivgswstdgyefesseavvdgkfvglaldldnqsgktdervaawlaqiapefglsl

SCOPe Domain Coordinates for d5k9ba_:

Click to download the PDB-style file with coordinates for d5k9ba_.
(The format of our PDB-style files is described here.)

Timeline for d5k9ba_:

  • d5k9ba_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03