Lineage for d5kmtb_ (5kmt B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (40 species)
    not a true protein
  7. 2218920Species Escherichia coli [TaxId:562] [225496] (14 PDB entries)
  8. 2293866Domain d5kmtb_: 5kmt B: [337167]
    automated match to d1o7eb_
    complexed with k, po4; mutant

Details for d5kmtb_

PDB Entry: 5kmt (more details), 1.7 Å

PDB Description: ctx-m9 mutant l48a
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5kmtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kmtb_ e.3.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
tsavqqklaalekssggrlgvaaidtadntqvlyrgderfpmcstskvmaaaavlkqset
qkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
lvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqp
qqnaesrrdvlasaariiaeg

SCOPe Domain Coordinates for d5kmtb_:

Click to download the PDB-style file with coordinates for d5kmtb_.
(The format of our PDB-style files is described here.)

Timeline for d5kmtb_:

  • d5kmtb_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03