SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kmta_ (5kmt A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (39 species)
    not a true protein
  7. 2218920Species Escherichia coli [TaxId:562] [225496] (14 PDB entries)
  8. 2293865Domain d5kmta_: 5kmt A: [337166]
    automated match to d1o7eb_
    complexed with k, po4; mutant

Details for d5kmta_

PDB Entry: 5kmt (more details), 1.7 Å

PDB Description: ctx-m9 mutant l48a
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5kmta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kmta_ e.3.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
tsavqqklaalekssggrlgvaaidtadntqvlyrgderfpmcstskvmaaaavlkqset
qkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
lvtwlkgnttgaasiraglptswtagdktgsgdygttndiaviwpqgraplvlvtyftqp
qqnaesrrdvlasaariiaeg

SCOPe Domain Coordinates for d5kmta_:

Click to download the PDB-style file with coordinates for d5kmta_.
(The format of our PDB-style files is described here.)

Timeline for d5kmta_:

  • d5kmta_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03