SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hudc1 (5hud C:11-472)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086424Family c.1.10.8: Class-II DAHP synthetase [141840] (2 protein domains)
    Pfam PF01474
  6. 2086439Protein automated matches [191084] (3 species)
    not a true protein
  7. 2293859Species Corynebacterium glutamicum [TaxId:1718] [337160] (3 PDB entries)
  8. 2293863Domain d5hudc1: 5hud C:11-472 [337164]
    Other proteins in same PDB: d5hudc2, d5hudd2
    automated match to d3kgfb_
    complexed with gol, mn, peg, pg4, pge, po4, trp, tsa

Details for d5hudc1

PDB Entry: 5hud (more details), 2.15 Å

PDB Description: non-covalent complex of and dahp synthase and chorismate mutase from corynebacterium glutamicum with bound transition state analog
PDB Compounds: (C:) 3-Deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase

SCOPe Domain Sequences for d5hudc1:

Sequence, based on SEQRES records: (download)

>d5hudc1 c.1.10.8 (C:11-472) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
mswtvdipkevlpdlpplpegmqqqfedtisrdakqqptwdraqaenvrkilesvppivv
apevlelkqkladvangkafllqggdcaetfesntephiranvktllqmavvltygastp
vikmariagqyakprssdldgnglpnyrgdivngveatpearrhdparmirayanasaam
nlvraltssgtadlyrlsewnrefvanspagaryealareidsglrfmeacgvsdeslra
adiycsheallvdyersmlrlatdeegneelydlsahqlwigertrgmddfhvnfasmis
npigikigpgitpeeavayadkldpnfepgrltivarmghdkvrsvlpgviqaveasghk
viwqsdpmhgntftasngyktrhfdkvidevqgffevhralgthpggihieftgedvtec
lggaeditdvdlpgryesacdprlntqqslelaflvaemlrn

Sequence, based on observed residues (ATOM records): (download)

>d5hudc1 c.1.10.8 (C:11-472) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
mswtvdilpegmqqqfedtisrdakqqptwdraqaenvrkilesvppivvapevlelkqk
ladvangkafllqggdcaetfesntephiranvktllqmavvltygastpvikmariagq
yakprssdldgnglpnyrgdivngveatpearrhdparmirayanasaamnlvraltssg
tadlyrlsewnrefvanspagaryealareidsglrfmeacgvsdeslraadiycsheal
lvdyersmlrlatdeegneelydlsahqlwigertrgmddfhvnfasmisnpigikigpg
itpeeavayadkldpnfepgrltivarmghdkvrsvlpgviqaveasghkviwqsdpmhg
ntftasngyktrhfdkvidevqgffevhralgthpggihieftgedvteclggaeditdv
dlpgryesacdprlntqqslelaflvaemlrn

SCOPe Domain Coordinates for d5hudc1:

Click to download the PDB-style file with coordinates for d5hudc1.
(The format of our PDB-style files is described here.)

Timeline for d5hudc1:

  • d5hudc1 appears in periodic updates to SCOPe 2.06 starting on 2017-08-03