SCOPe 2.06: Domain d5huca_: 5huc A:

Lineage for d5huca_ (5huc A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.8: Class-II DAHP synthetase [141840] (2 proteins)
   Pfam PF01474

6. Protein automated matches [191084] (3 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [337160] (3 PDB entries)

8. Domain d5huca_: 5huc A: [337161]
   automated match to d3kgfb_
   complexed with mn, mpd, pep, po4, trp

Details for d5huca_

PDB Entry: 5huc, 2.45 Å

PDB Description: dahp synthase from corynebacterium glutamicum

PDB Compounds: (A:) 3-Deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase

SCOPe Domain Sequences for d5huca_:

Sequence; same for both SEQRES and ATOM records:

>d5huca_ c.1.10.8 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dlpplpegmqqqfedtisrdakqqptwdraqaenvrkilesvppivvapevlelkqklad
vangkafllqggdcaetfesntephiranvktllqmavvltygastpvikmariagqyak
prssdldgnglpnyrgdivngveatpearrhdparmirayanasaamnlvraltssgtad
lyrlsewnrefvanspagaryealareidsglrfmeacgvsdeslraadiycsheallvd
yersmlrlatdeegneelydlsahqlwigertrgmddfhvnfasmisnpigikigpgitp
eeavayadkldpnfepgrltivarmghdkvrsvlpgviqaveasghkviwqsdpmhgntf
tasngyktrhfdkvidevqgffevhralgthpggihieftgedvteclggaeditdvdlp
gryesacdprlntqqslelaflvaemlrn

Timeline for d5huca_:

• d5huca_ is new in SCOPe 2.06-stable
  
• d5huca_ appears in SCOPe 2.07
  
• d5huca_ appears in the current release, SCOPe 2.08