SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5huca_ (5huc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086424Family c.1.10.8: Class-II DAHP synthetase [141840] (2 protein domains)
    Pfam PF01474
  6. 2086439Protein automated matches [191084] (3 species)
    not a true protein
  7. 2293859Species Corynebacterium glutamicum [TaxId:1718] [337160] (3 PDB entries)
  8. 2293860Domain d5huca_: 5huc A: [337161]
    automated match to d3kgfb_
    complexed with mn, mpd, pep, po4, trp

Details for d5huca_

PDB Entry: 5huc (more details), 2.45 Å

PDB Description: dahp synthase from corynebacterium glutamicum
PDB Compounds: (A:) 3-Deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase

SCOPe Domain Sequences for d5huca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5huca_ c.1.10.8 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dlpplpegmqqqfedtisrdakqqptwdraqaenvrkilesvppivvapevlelkqklad
vangkafllqggdcaetfesntephiranvktllqmavvltygastpvikmariagqyak
prssdldgnglpnyrgdivngveatpearrhdparmirayanasaamnlvraltssgtad
lyrlsewnrefvanspagaryealareidsglrfmeacgvsdeslraadiycsheallvd
yersmlrlatdeegneelydlsahqlwigertrgmddfhvnfasmisnpigikigpgitp
eeavayadkldpnfepgrltivarmghdkvrsvlpgviqaveasghkviwqsdpmhgntf
tasngyktrhfdkvidevqgffevhralgthpggihieftgedvteclggaeditdvdlp
gryesacdprlntqqslelaflvaemlrn

SCOPe Domain Coordinates for d5huca_:

Click to download the PDB-style file with coordinates for d5huca_.
(The format of our PDB-style files is described here.)

Timeline for d5huca_:

  • d5huca_ appears in periodic updates to SCOPe 2.06 starting on 2017-08-03