SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wgbc_ (5wgb C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991985Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1991986Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1991987Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 protein domains)
  6. 1991992Protein Acyl carrier protein [47338] (7 species)
  7. 2293854Species Escherichia coli [TaxId:585035] [337155] (1 PDB entry)
  8. 2293855Domain d5wgbc_: 5wgb C: [337156]
    automated match to d1t8ka_
    complexed with 8q1, plp

Details for d5wgbc_

PDB Entry: 5wgb (more details), 2.75 Å

PDB Description: crystal structure of the human mitochondrial cysteine desulfurase in complex with isd11 and e. coli acp1 protein at 2.75a
PDB Compounds: (C:) Acyl carrier protein

SCOPe Domain Sequences for d5wgbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wgbc_ a.28.1.1 (C:) Acyl carrier protein {Escherichia coli [TaxId: 585035]}
ieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeaeki
ttvqaaidyin

SCOPe Domain Coordinates for d5wgbc_:

Click to download the PDB-style file with coordinates for d5wgbc_.
(The format of our PDB-style files is described here.)

Timeline for d5wgbc_:

  • d5wgbc_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-28