Lineage for d5wgbc_ (5wgb C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991985Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1991986Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1991987Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 protein domains)
  6. 1991992Protein Acyl carrier protein [47338] (7 species)
  7. 2293854Species Escherichia coli [TaxId:585035] [337155] (1 PDB entry)
  8. 2293855Domain d5wgbc_: 5wgb C: [337156]
    automated match to d1t8ka_
    complexed with 8q1, plp

Details for d5wgbc_

PDB Entry: 5wgb (more details), 2.75 Å

PDB Description: crystal structure of the human mitochondrial cysteine desulfurase in complex with isd11 and e. coli acp1 protein at 2.75a
PDB Compounds: (C:) Acyl carrier protein

SCOPe Domain Sequences for d5wgbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wgbc_ a.28.1.1 (C:) Acyl carrier protein {Escherichia coli [TaxId: 585035]}
ieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeaeki
ttvqaaidyin

SCOPe Domain Coordinates for d5wgbc_:

Click to download the PDB-style file with coordinates for d5wgbc_.
(The format of our PDB-style files is described here.)

Timeline for d5wgbc_:

  • d5wgbc_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-28