SCOPe 2.08: Domain d5xn9b1: 5xn9 B:31-166

Lineage for d5xn9b1 (5xn9 B:31-166)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (25 species)
   not a true protein

7. Species Ramazzottius varieornatus [TaxId:947166] [337124] (2 PDB entries)

8. Domain d5xn9b1: 5xn9 B:31-166 [337152]
   Other proteins in same PDB: d5xn9a2, d5xn9b2
   automated match to d2poaa_
   complexed with acy, cl, edo, mg, zn

Details for d5xn9b1

PDB Entry: 5xn9, 1.45 Å

PDB Description: crystal structure of a secretary abundant heat soluble (sahs) protein from ramazzottius varieornatus (from monomer sample)

PDB Compounds: (B:) sahs1

SCOPe Domain Sequences for d5xn9b1:

Sequence; same for both SEQRES and ATOM records:

>d5xn9b1 b.60.1.0 (B:31-166) automated matches {Ramazzottius varieornatus [TaxId: 947166]}
ewtgkswmgkwestdrienfdafisalglpleqyggnhktfhkiwkegdhyhhqisvpdk
nykndvnfklneegttqhnnteikykytedggnlkaevhvpsrnkvihdeykvngdelek
tykvgdvtakrwykks

Timeline for d5xn9b1:

• d5xn9b1 first appeared in SCOPe 2.06
  
• d5xn9b1 appears in SCOPe 2.07