Lineage for d5xn9b1 (5xn9 B:31-166)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063481Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2063482Protein automated matches [190698] (20 species)
    not a true protein
  7. 2293823Species Ramazzottius varieornatus [TaxId:947166] [337124] (2 PDB entries)
  8. 2293851Domain d5xn9b1: 5xn9 B:31-166 [337152]
    Other proteins in same PDB: d5xn9a2, d5xn9b2
    automated match to d2poaa_
    complexed with acy, cl, edo, mg, zn

Details for d5xn9b1

PDB Entry: 5xn9 (more details), 1.45 Å

PDB Description: crystal structure of a secretary abundant heat soluble (sahs) protein from ramazzottius varieornatus (from monomer sample)
PDB Compounds: (B:) sahs1

SCOPe Domain Sequences for d5xn9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xn9b1 b.60.1.0 (B:31-166) automated matches {Ramazzottius varieornatus [TaxId: 947166]}
ewtgkswmgkwestdrienfdafisalglpleqyggnhktfhkiwkegdhyhhqisvpdk
nykndvnfklneegttqhnnteikykytedggnlkaevhvpsrnkvihdeykvngdelek
tykvgdvtakrwykks

SCOPe Domain Coordinates for d5xn9b1:

Click to download the PDB-style file with coordinates for d5xn9b1.
(The format of our PDB-style files is described here.)

Timeline for d5xn9b1:

  • d5xn9b1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5xn9b2