SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wceb2 (5wce B:119-250)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2193533Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2193534Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2193902Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2193903Protein automated matches [226907] (17 species)
    not a true protein
  7. 2293814Species Caulobacter crescentus [TaxId:190650] [337115] (1 PDB entry)
  8. 2293849Domain d5wceb2: 5wce B:119-250 [337150]
    automated match to d4tr8a2

Details for d5wceb2

PDB Entry: 5wce (more details), 1.9 Å

PDB Description: caulobacter crescentus pol iii beta
PDB Compounds: (B:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d5wceb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wceb2 d.131.1.0 (B:119-250) automated matches {Caulobacter crescentus [TaxId: 190650]}
vmssdglssriavdtnelirlidktrfaisteetryylnglyvhtvneggetklravatd
ghrlalaempapegavgipgvivprktiaearrlmesagetvdlqvspqkvrfefgaaal
tskvidgafpdy

SCOPe Domain Coordinates for d5wceb2:

Click to download the PDB-style file with coordinates for d5wceb2.
(The format of our PDB-style files is described here.)

Timeline for d5wceb2:

  • d5wceb2 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27