SCOPe 2.06: Domain d5xn9a1: 5xn9 A:31-167

Lineage for d5xn9a1 (5xn9 A:31-167)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (21 species)
   not a true protein

7. Species Ramazzottius varieornatus [TaxId:947166] [337124] (2 PDB entries)

8. Domain d5xn9a1: 5xn9 A:31-167 [337147]
   Other proteins in same PDB: d5xn9a2, d5xn9b2
   automated match to d2poaa_
   complexed with acy, cl, edo, mg, zn

Details for d5xn9a1

PDB Entry: 5xn9, 1.45 Å

PDB Description: crystal structure of a secretary abundant heat soluble (sahs) protein from ramazzottius varieornatus (from monomer sample)

PDB Compounds: (A:) sahs1

SCOPe Domain Sequences for d5xn9a1:

Sequence; same for both SEQRES and ATOM records:

>d5xn9a1 b.60.1.0 (A:31-167) automated matches {Ramazzottius varieornatus [TaxId: 947166]}
ewtgkswmgkwestdrienfdafisalglpleqyggnhktfhkiwkegdhyhhqisvpdk
nykndvnfklneegttqhnnteikykytedggnlkaevhvpsrnkvihdeykvngdelek
tykvgdvtakrwykkss

Timeline for d5xn9a1:

• d5xn9a1 is new in SCOPe 2.06-stable
  
• d5xn9a1 appears in SCOPe 2.07
  
• d5xn9a1 appears in the current release, SCOPe 2.08