SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gnoa3 (5gno A:336-516)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036937Family b.6.1.3: Multidomain cupredoxins [49550] (8 protein domains)
  6. 2037062Protein multi-copper oxidase CueO [69194] (1 species)
  7. 2037063Species Escherichia coli [TaxId:562] [69195] (34 PDB entries)
  8. 2293842Domain d5gnoa3: 5gno A:336-516 [337143]
    automated match to d4e9sa3
    complexed with ca, cu, edo

Details for d5gnoa3

PDB Entry: 5gno (more details), 1.45 Å

PDB Description: structure of multicopper oxidase cueo - signal peptide-free
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d5gnoa3:

Sequence, based on SEQRES records: (download)

>d5gnoa3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft
v

Sequence, based on observed residues (ATOM records): (download)

>d5gnoa3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdfhhankingqafdmn
kpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdtvkvegn
vsevlvkfnhdapkehaymahchllehedtgmmlgftv

SCOPe Domain Coordinates for d5gnoa3:

Click to download the PDB-style file with coordinates for d5gnoa3.
(The format of our PDB-style files is described here.)

Timeline for d5gnoa3:

  • d5gnoa3 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27