SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gnoa1 (5gno A:31-170)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036937Family b.6.1.3: Multidomain cupredoxins [49550] (8 protein domains)
  6. 2037062Protein multi-copper oxidase CueO [69194] (1 species)
  7. 2037063Species Escherichia coli [TaxId:562] [69195] (34 PDB entries)
  8. 2293840Domain d5gnoa1: 5gno A:31-170 [337141]
    automated match to d1kv7a1
    complexed with ca, cu, edo

Details for d5gnoa1

PDB Entry: 5gno (more details), 1.45 Å

PDB Description: structure of multicopper oxidase cueo - signal peptide-free
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d5gnoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gnoa1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
rptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtvdi
ynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgktgr
qvamglaglvvieddeilkl

SCOPe Domain Coordinates for d5gnoa1:

Click to download the PDB-style file with coordinates for d5gnoa1.
(The format of our PDB-style files is described here.)

Timeline for d5gnoa1:

  • d5gnoa1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27