Lineage for d5w6va3 (5w6v A:576-857)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2462855Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2464026Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2464027Protein automated matches [190396] (36 species)
    not a true protein
  7. 2464113Species Human (Homo sapiens) [TaxId:9606] [225370] (6 PDB entries)
  8. 2464120Domain d5w6va3: 5w6v A:576-857 [337137]
    Other proteins in same PDB: d5w6va1, d5w6va2
    automated match to d4krea3
    protein/RNA complex

Details for d5w6va3

PDB Entry: 5w6v (more details), 2.83 Å

PDB Description: the structure of human argonaute-1 in complex with the hook motif of human gw182
PDB Compounds: (A:) Protein argonaute-1

SCOPe Domain Sequences for d5w6va3:

Sequence, based on SEQRES records: (download)

>d5w6va3 c.55.3.0 (A:576-857) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvphqrsavfqqpviflgadvthppagdgkkpsitavvgsmdahpsrycatvrvqrprqe
iiedlsymvrelliqfykstrfkptriifyrdgvpegqlpqilhyellairdaciklekd
yqpgityivvqkrhhtrlfcadknerigksgnipagttvdtnithpfefdfylcshagiq
gtsrpshyyvlwddnrftadelqiltyqlchtyvrctrsvsipapayyarlvafraryhl
vdkehdsgegshisgqsngrdpqalakavqvhqdtlrtmyfa

Sequence, based on observed residues (ATOM records): (download)

>d5w6va3 c.55.3.0 (A:576-857) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvphqrsavfqqpviflgadvthppakkpsitavvgsmdahpsrycatvrvqrprqeiie
dlsymvrelliqfykstrfkptriifyrdgvpegqlpqilhyellairdaciklekdyqp
gityivvqkrhhtrlfcadknerigksgnipagttvdtnithpfefdfylcshagiqgts
rpshyyvlwddnrftadelqiltyqlchtyvrctrsvsipapayyarlvafraryhlvdd
pqalakavqvhqdtlrtmyfa

SCOPe Domain Coordinates for d5w6va3:

Click to download the PDB-style file with coordinates for d5w6va3.
(The format of our PDB-style files is described here.)

Timeline for d5w6va3: