SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5w6va3 (5w6v A:576-857)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124881Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2124882Protein automated matches [190396] (34 species)
    not a true protein
  7. 2124966Species Human (Homo sapiens) [TaxId:9606] [225370] (6 PDB entries)
  8. 2293836Domain d5w6va3: 5w6v A:576-857 [337137]
    Other proteins in same PDB: d5w6va1, d5w6va2
    automated match to d4krea3
    protein/RNA complex

Details for d5w6va3

PDB Entry: 5w6v (more details), 2.83 Å

PDB Description: the structure of human argonaute-1 in complex with the hook motif of human gw182
PDB Compounds: (A:) Protein argonaute-1

SCOPe Domain Sequences for d5w6va3:

Sequence, based on SEQRES records: (download)

>d5w6va3 c.55.3.0 (A:576-857) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvphqrsavfqqpviflgadvthppagdgkkpsitavvgsmdahpsrycatvrvqrprqe
iiedlsymvrelliqfykstrfkptriifyrdgvpegqlpqilhyellairdaciklekd
yqpgityivvqkrhhtrlfcadknerigksgnipagttvdtnithpfefdfylcshagiq
gtsrpshyyvlwddnrftadelqiltyqlchtyvrctrsvsipapayyarlvafraryhl
vdkehdsgegshisgqsngrdpqalakavqvhqdtlrtmyfa

Sequence, based on observed residues (ATOM records): (download)

>d5w6va3 c.55.3.0 (A:576-857) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvphqrsavfqqpviflgadvthppakkpsitavvgsmdahpsrycatvrvqrprqeiie
dlsymvrelliqfykstrfkptriifyrdgvpegqlpqilhyellairdaciklekdyqp
gityivvqkrhhtrlfcadknerigksgnipagttvdtnithpfefdfylcshagiqgts
rpshyyvlwddnrftadelqiltyqlchtyvrctrsvsipapayyarlvafraryhlvdd
pqalakavqvhqdtlrtmyfa

SCOPe Domain Coordinates for d5w6va3:

Click to download the PDB-style file with coordinates for d5w6va3.
(The format of our PDB-style files is described here.)

Timeline for d5w6va3:

  • d5w6va3 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27