SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5w6va2 (5w6v A:411-575)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116033Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2116195Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) (S)
  5. 2116247Family c.44.3.0: automated matches [310677] (1 protein)
    not a true family
  6. 2116248Protein automated matches [310878] (2 species)
    not a true protein
  7. 2116249Species Human (Homo sapiens) [TaxId:9606] [311393] (4 PDB entries)
  8. 2293835Domain d5w6va2: 5w6v A:411-575 [337136]
    Other proteins in same PDB: d5w6va1, d5w6va3
    automated match to d4krea2
    protein/RNA complex

Details for d5w6va2

PDB Entry: 5w6v (more details), 2.83 Å

PDB Description: the structure of human argonaute-1 in complex with the hook motif of human gw182
PDB Compounds: (A:) Protein argonaute-1

SCOPe Domain Sequences for d5w6va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w6va2 c.44.3.0 (A:411-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpapilqyggrnraiatpnqgvwdmrgkqfyngieikvwaiacfapqkqcreevlknftd
qlrkiskdagmpiqgqpcfckyaqgadsvepmfrhlkntysglqliivilpgktpvyaev
krvgdtllgmatqcvqvknvvktspqtlsnlclkinvklgginni

SCOPe Domain Coordinates for d5w6va2:

Click to download the PDB-style file with coordinates for d5w6va2.
(The format of our PDB-style files is described here.)

Timeline for d5w6va2:

  • d5w6va2 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27