Lineage for d5w6va2 (5w6v A:411-575)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116033Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2116195Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) (S)
  5. 2116247Family c.44.3.0: automated matches [310677] (1 protein)
    not a true family
  6. 2116248Protein automated matches [310878] (2 species)
    not a true protein
  7. 2116249Species Human (Homo sapiens) [TaxId:9606] [311393] (4 PDB entries)
  8. 2293835Domain d5w6va2: 5w6v A:411-575 [337136]
    Other proteins in same PDB: d5w6va1, d5w6va3
    automated match to d4krea2
    protein/RNA complex

Details for d5w6va2

PDB Entry: 5w6v (more details), 2.83 Å

PDB Description: the structure of human argonaute-1 in complex with the hook motif of human gw182
PDB Compounds: (A:) Protein argonaute-1

SCOPe Domain Sequences for d5w6va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w6va2 c.44.3.0 (A:411-575) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpapilqyggrnraiatpnqgvwdmrgkqfyngieikvwaiacfapqkqcreevlknftd
qlrkiskdagmpiqgqpcfckyaqgadsvepmfrhlkntysglqliivilpgktpvyaev
krvgdtllgmatqcvqvknvvktspqtlsnlclkinvklgginni

SCOPe Domain Coordinates for d5w6va2:

Click to download the PDB-style file with coordinates for d5w6va2.
(The format of our PDB-style files is described here.)

Timeline for d5w6va2:

  • d5w6va2 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27