SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5w6va1 (5w6v A:21-410)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047718Superfamily b.34.14: PAZ domain [101690] (2 families) (S)
  5. 2047758Family b.34.14.0: automated matches [310679] (1 protein)
    not a true family
  6. 2047759Protein automated matches [310889] (1 species)
    not a true protein
  7. 2047760Species Human (Homo sapiens) [TaxId:9606] [311392] (4 PDB entries)
  8. 2293834Domain d5w6va1: 5w6v A:21-410 [337135]
    Other proteins in same PDB: d5w6va2, d5w6va3
    automated match to d4krea1
    protein/RNA complex

Details for d5w6va1

PDB Entry: 5w6v (more details), 2.83 Å

PDB Description: the structure of human argonaute-1 in complex with the hook motif of human gw182
PDB Compounds: (A:) Protein argonaute-1

SCOPe Domain Sequences for d5w6va1:

Sequence, based on SEQRES records: (download)

>d5w6va1 b.34.14.0 (A:21-410) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqaprrpgigtvgkpikllanyfevdipkidvyhyevdikpdkcprrvnrevveymvqhf
kpqifgdrkpvydgkkniytvtalpignervdfevtipgegkdrifkvsikwlaivswrm
lhealvsgqipvplesvqaldvamrhlasmrytpvgrsffsppegyyhplgggrevwfgf
hqsvrpamwkmmlnidvsatafykaqpviefmcevldirnideqpkpltdsqrvrftkei
kglkvevthcgqmkrkyrvcnvtrrpashqtfplqlesgqtvectvaqyfkqkynlqlky
phlpclqvgqeqkhtylplevcnivagqrcikkltdnqtstmikatarsapdrqeeisrl
mknasynldpyiqefgikvkddmtevtgrv

Sequence, based on observed residues (ATOM records): (download)

>d5w6va1 b.34.14.0 (A:21-410) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fqaprrpgigtvgkpikllanyfevdipkidvyhyevdikpdkcprrvnrevveymvqhf
kpqifgdrkpvydgkkniytvtalpignervdfevtipgkdrifkvsikwlaivswrmlh
ealvsgqipvplesvqaldvamrhlasmrytpvgrsffsppegyyhplgggrevwfgfhq
svrpamwkmmlnidvsatafykaqpviefmcevldirnqpkpltdsqrvrftkeikglkv
evthckrkyrvcnvtrrpashqtfpectvaqyfkqkynlqlkyphlpclqvqkhtylple
vcnivagqrcikkltdnqtstmikatarsapdrqeeisrlmknasynldpyiqefgikvk
ddmtevtgrv

SCOPe Domain Coordinates for d5w6va1:

Click to download the PDB-style file with coordinates for d5w6va1.
(The format of our PDB-style files is described here.)

Timeline for d5w6va1:

  • d5w6va1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27