SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xg4u_ (5xg4 U:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2057409Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 2057410Species Human (Homo sapiens) [TaxId:9606] [50587] (79 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 2293830Domain d5xg4u_: 5xg4 U: [337131]
    automated match to d4h42u_
    complexed with pg6, que

Details for d5xg4u_

PDB Entry: 5xg4 (more details), 3 Å

PDB Description: crystal structure of upa in complex with quercetin
PDB Compounds: (U:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d5xg4u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xg4u_ b.47.1.2 (U:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtk

SCOPe Domain Coordinates for d5xg4u_:

Click to download the PDB-style file with coordinates for d5xg4u_.
(The format of our PDB-style files is described here.)

Timeline for d5xg4u_:

  • d5xg4u_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27