Lineage for d5xcza_ (5xcz A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097504Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2097505Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2097506Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 protein domains)
    Pfam PF01341
  6. 2097550Protein automated matches [191253] (7 species)
    not a true protein
  7. 2293828Species Phanerochaete chrysosporium [TaxId:5306] [337129] (2 PDB entries)
  8. 2293829Domain d5xcza_: 5xcz A: [337130]
    automated match to d1gz1a_
    complexed with bgc, glc, trs

Details for d5xcza_

PDB Entry: 5xcz (more details), 2.1 Å

PDB Description: structure of the cellobiohydrolase cel6a from phanerochaete chrysosporium in complex with cellobiose at 2.1 angstrom
PDB Compounds: (A:) glucanase

SCOPe Domain Sequences for d5xcza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xcza_ c.6.1.1 (A:) automated matches {Phanerochaete chrysosporium [TaxId: 5306]}
sannpwtgfqiflspyyanevaaaakqitdptlsskaasvaniptftwldsvakipdlgt
ylasasalgkstgtkqlvqiviydlpdrdcaakasngefsianngqanyenyidqivaqi
qqfpdvrvvaviepdslanlvtnlnvqkcanakttylacvnyaltnlakvgvymymdagh
agwlgwpanlspaaqlftqvwqnagkspfikglatnvanynalqaaspdpitqgnpnyde
ihyinalapllqqagwdatfivdqgrsgvqnirqqwgdwcnikgagfgtrpttntgsqfi
dsivwvkpggecdgtsnsssprydstcslpdaaqpapeagtwfqayfqtlvsaanppl

SCOPe Domain Coordinates for d5xcza_:

Click to download the PDB-style file with coordinates for d5xcza_.
(The format of our PDB-style files is described here.)

Timeline for d5xcza_:

  • d5xcza_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27