SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xcza_ (5xcz A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097504Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2097505Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 2097506Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (4 protein domains)
    Pfam PF01341
  6. 2097550Protein automated matches [191253] (7 species)
    not a true protein
  7. 2293828Species Phanerochaete chrysosporium [TaxId:5306] [337129] (2 PDB entries)
  8. 2293829Domain d5xcza_: 5xcz A: [337130]
    automated match to d1gz1a_
    complexed with bgc, glc, trs

Details for d5xcza_

PDB Entry: 5xcz (more details), 2.1 Å

PDB Description: structure of the cellobiohydrolase cel6a from phanerochaete chrysosporium in complex with cellobiose at 2.1 angstrom
PDB Compounds: (A:) glucanase

SCOPe Domain Sequences for d5xcza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xcza_ c.6.1.1 (A:) automated matches {Phanerochaete chrysosporium [TaxId: 5306]}
sannpwtgfqiflspyyanevaaaakqitdptlsskaasvaniptftwldsvakipdlgt
ylasasalgkstgtkqlvqiviydlpdrdcaakasngefsianngqanyenyidqivaqi
qqfpdvrvvaviepdslanlvtnlnvqkcanakttylacvnyaltnlakvgvymymdagh
agwlgwpanlspaaqlftqvwqnagkspfikglatnvanynalqaaspdpitqgnpnyde
ihyinalapllqqagwdatfivdqgrsgvqnirqqwgdwcnikgagfgtrpttntgsqfi
dsivwvkpggecdgtsnsssprydstcslpdaaqpapeagtwfqayfqtlvsaanppl

SCOPe Domain Coordinates for d5xcza_:

Click to download the PDB-style file with coordinates for d5xcza_.
(The format of our PDB-style files is described here.)

Timeline for d5xcza_:

  • d5xcza_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27