SCOPe 2.06: Domain d5xnaa1: 5xna A:31-166

Lineage for d5xnaa1 (5xna A:31-166)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (21 species)
   not a true protein

7. Species Ramazzottius varieornatus [TaxId:947166] [337124] (2 PDB entries)

8. Domain d5xnaa1: 5xna A:31-166 [337127]
   Other proteins in same PDB: d5xnaa2, d5xnab2
   automated match to d2poaa_
   complexed with acy, cl, edo, mg, shv, zn

Details for d5xnaa1

PDB Entry: 5xna, 1.8 Å

PDB Description: crystal structure of a secretary abundant heat soluble (sahs) protein from ramazzottius varieornatus (from dimer sample)

PDB Compounds: (A:) sahs1

SCOPe Domain Sequences for d5xnaa1:

Sequence; same for both SEQRES and ATOM records:

>d5xnaa1 b.60.1.0 (A:31-166) automated matches {Ramazzottius varieornatus [TaxId: 947166]}
ewtgkswmgkwestdrienfdafisalglpleqyggnhktfhkiwkegdhyhhqisvpdk
nykndvnfklneegttqhnnteikykytedggnlkaevhvpsrnkvihdeykvngdelek
tykvgdvtakrwykks

Timeline for d5xnaa1:

• d5xnaa1 is new in SCOPe 2.06-stable
  
• d5xnaa1 appears in SCOPe 2.07
  
• d5xnaa1 appears in the current release, SCOPe 2.08