SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xnaa1 (5xna A:31-166)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063481Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2063482Protein automated matches [190698] (20 species)
    not a true protein
  7. 2293823Species Ramazzottius varieornatus [TaxId:947166] [337124] (2 PDB entries)
  8. 2293826Domain d5xnaa1: 5xna A:31-166 [337127]
    Other proteins in same PDB: d5xnaa2, d5xnab2
    automated match to d2poaa_
    complexed with acy, cl, edo, mg, shv, zn

Details for d5xnaa1

PDB Entry: 5xna (more details), 1.8 Å

PDB Description: crystal structure of a secretary abundant heat soluble (sahs) protein from ramazzottius varieornatus (from dimer sample)
PDB Compounds: (A:) sahs1

SCOPe Domain Sequences for d5xnaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xnaa1 b.60.1.0 (A:31-166) automated matches {Ramazzottius varieornatus [TaxId: 947166]}
ewtgkswmgkwestdrienfdafisalglpleqyggnhktfhkiwkegdhyhhqisvpdk
nykndvnfklneegttqhnnteikykytedggnlkaevhvpsrnkvihdeykvngdelek
tykvgdvtakrwykks

SCOPe Domain Coordinates for d5xnaa1:

Click to download the PDB-style file with coordinates for d5xnaa1.
(The format of our PDB-style files is described here.)

Timeline for d5xnaa1:

  • d5xnaa1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5xnaa2