Lineage for d5w7zb3 (5w7z B:249-379)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215792Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2215793Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2216175Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2216176Protein automated matches [226907] (20 species)
    not a true protein
  7. 2216338Species Rickettsia conorii [TaxId:272944] [337105] (1 PDB entry)
  8. 2216344Domain d5w7zb3: 5w7z B:249-379 [337122]
    Other proteins in same PDB: d5w7za4, d5w7zb4
    automated match to d1ok7a3
    complexed with edo, mrd

Details for d5w7zb3

PDB Entry: 5w7z (more details), 1.7 Å

PDB Description: crystal structure of dna polymerase iii subunit beta from rickettsia conorii
PDB Compounds: (B:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d5w7zb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w7zb3 d.131.1.0 (B:249-379) automated matches {Rickettsia conorii [TaxId: 272944]}
stfipessssklvinrkmfadsieriaiitvekfravklslsretleisavgeargnake
vinssqdkesfyeynsdeslaigfnpqyledvlkavksdvvelyfsdvsapvlikfpenp
kdifvvmpvkv

SCOPe Domain Coordinates for d5w7zb3:

Click to download the PDB-style file with coordinates for d5w7zb3.
(The format of our PDB-style files is described here.)

Timeline for d5w7zb3: