SCOPe 2.08: Domain d5w7zb2: 5w7z B:123-248

Lineage for d5w7zb2 (5w7z B:123-248)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Rickettsia conorii [TaxId:272944] [337105] (1 PDB entry)

8. Domain d5w7zb2: 5w7z B:123-248 [337121]
   Other proteins in same PDB: d5w7za4, d5w7zb4
   automated match to d1ok7a2
   complexed with edo, mrd

Details for d5w7zb2

PDB Entry: 5w7z, 1.7 Å

PDB Description: crystal structure of dna polymerase iii subunit beta from rickettsia conorii

PDB Compounds: (B:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d5w7zb2:

Sequence; same for both SEQRES and ATOM records:

>d5w7zb2 d.131.1.0 (B:123-248) automated matches {Rickettsia conorii [TaxId: 272944]}
npeasfkisctdfakiiestkfsisldetrynlngvylhikdkefcsastdghrlsiswv
tlekqiknfgvilpqksaeeilkivkdpkninedieillssnkikficnentsmlsklid
gtfpdy

Timeline for d5w7zb2:

• d5w7zb2 first appeared in SCOPe 2.06
  
• d5w7zb2 appears in SCOPe 2.07