Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (20 species) not a true protein |
Species Rickettsia conorii [TaxId:272944] [337105] (1 PDB entry) |
Domain d5w7zb1: 5w7z B:1-122 [337120] Other proteins in same PDB: d5w7za4, d5w7zb4 automated match to d1ok7a1 complexed with edo, mrd |
PDB Entry: 5w7z (more details), 1.7 Å
SCOPe Domain Sequences for d5w7zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w7zb1 d.131.1.0 (B:1-122) automated matches {Rickettsia conorii [TaxId: 272944]} mlklivetktlvqslgfassvvekrnvipeyaniklsakdgnlelsstnmdlylsqkiav qvvsegectvstktlndivrklpdseltltdlgttgleikgknckfnlftlpvssfpamd si
Timeline for d5w7zb1:
View in 3D Domains from other chains: (mouse over for more information) d5w7za1, d5w7za2, d5w7za3, d5w7za4 |