SCOP 1.67: Domain d1t7pa1: 1t7p A:1-210

Lineage for d1t7pa1 (1t7p A:1-210)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (9 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)

6. Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species)

7. Species Bacteriophage T7 [TaxId:10760] [53124] (1 PDB entry)

8. Domain d1t7pa1: 1t7p A:1-210 [33712]
   Other proteins in same PDB: d1t7pa2, d1t7pb_
   protein/DNA complex; complexed with 2da, dg3, mg; mutant

Details for d1t7pa1

PDB Entry: 1t7p, 2.2 Å

PDB Description: t7 dna polymerase complexed to dna primer/template,a nucleoside triphosphate, and its processivity factor thioredoxin

SCOP Domain Sequences for d1t7pa1:

Sequence; same for both SEQRES and ATOM records:

>d1t7pa1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7}
mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
sdkhyfppeidftdvgyttfwses

Timeline for d1t7pa1:

• d1t7pa1 first appeared (with stable ids) in SCOP 1.55
  
• d1t7pa1 appears in SCOP 1.65
  
• d1t7pa1 appears in SCOP 1.69
  
• d1t7pa1 appears in the current release, SCOPe 2.08