Lineage for d5wcea3 (5wce A:251-372)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2193533Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2193534Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2193902Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2193903Protein automated matches [226907] (17 species)
    not a true protein
  7. 2293814Species Caulobacter crescentus [TaxId:190650] [337115] (1 PDB entry)
  8. 2293817Domain d5wcea3: 5wce A:251-372 [337118]
    automated match to d4tr8a3

Details for d5wcea3

PDB Entry: 5wce (more details), 1.9 Å

PDB Description: caulobacter crescentus pol iii beta
PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d5wcea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wcea3 d.131.1.0 (A:251-372) automated matches {Caulobacter crescentus [TaxId: 190650]}
mrviprdnakiltldndlfakavdrvatisaeksrsvklavepgritltvrnmeagqave
evevdydgepfeigfnarylldvcgqiagpqaefrfadpasptlvvdpvdpgvkyvlmpl
rv

SCOPe Domain Coordinates for d5wcea3:

Click to download the PDB-style file with coordinates for d5wcea3.
(The format of our PDB-style files is described here.)

Timeline for d5wcea3:

  • d5wcea3 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27