SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wcea3 (5wce A:251-372)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2193533Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2193534Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2193902Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2193903Protein automated matches [226907] (17 species)
    not a true protein
  7. 2293814Species Caulobacter crescentus [TaxId:190650] [337115] (1 PDB entry)
  8. 2293817Domain d5wcea3: 5wce A:251-372 [337118]
    automated match to d4tr8a3

Details for d5wcea3

PDB Entry: 5wce (more details), 1.9 Å

PDB Description: caulobacter crescentus pol iii beta
PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d5wcea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wcea3 d.131.1.0 (A:251-372) automated matches {Caulobacter crescentus [TaxId: 190650]}
mrviprdnakiltldndlfakavdrvatisaeksrsvklavepgritltvrnmeagqave
evevdydgepfeigfnarylldvcgqiagpqaefrfadpasptlvvdpvdpgvkyvlmpl
rv

SCOPe Domain Coordinates for d5wcea3:

Click to download the PDB-style file with coordinates for d5wcea3.
(The format of our PDB-style files is described here.)

Timeline for d5wcea3:

  • d5wcea3 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27