Lineage for d5wcia1 (5wci A:174-449)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2187566Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 protein domains)
  6. 2187822Protein Probable histone acetyltransferase MYST1 [143672] (1 species)
    ESA1 orthologue
  7. 2187823Species Human (Homo sapiens) [TaxId:9606] [143673] (2 PDB entries)
    Uniprot Q9H7Z6 178-448
  8. 2293811Domain d5wcia1: 5wci A:174-449 [337112]
    Other proteins in same PDB: d5wcia2
    automated match to d2giva1
    complexed with 1vu, cl, edo, zn

Details for d5wcia1

PDB Entry: 5wci (more details), 1.78 Å

PDB Description: human myst histone acetyltransferase 1
PDB Compounds: (A:) Histone acetyltransferase KAT8

SCOPe Domain Sequences for d5wcia1:

Sequence, based on SEQRES records: (download)

>d5wcia1 d.108.1.1 (A:174-449) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]}
tkvkyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwr
qppgkeiyrksnisvhevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdr
qgahivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekpl
sdlgklsyrsywswvllenlrdfrgtlsikdlsqmtsitqndiistlqslnmvkywkgqh
vicvtpklveehlksaqykkppitvdsvclkwappk

Sequence, based on observed residues (ATOM records): (download)

>d5wcia1 d.108.1.1 (A:174-449) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]}
tkvkyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwr
qppgkeiyrksnisvhevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdr
qgahivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekpl
sdlgklsyrsywswvllenlrdfrglsikdlsqmtsitqndiistlqslnmvkywkgqhv
icvtpklveehlksaqykppitvdsvclkwappk

SCOPe Domain Coordinates for d5wcia1:

Click to download the PDB-style file with coordinates for d5wcia1.
(The format of our PDB-style files is described here.)

Timeline for d5wcia1:

  • d5wcia1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5wcia2