SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wcia1 (5wci A:174-449)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2187566Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 protein domains)
  6. 2187822Protein Probable histone acetyltransferase MYST1 [143672] (1 species)
    ESA1 orthologue
  7. 2187823Species Human (Homo sapiens) [TaxId:9606] [143673] (2 PDB entries)
    Uniprot Q9H7Z6 178-448
  8. 2293811Domain d5wcia1: 5wci A:174-449 [337112]
    Other proteins in same PDB: d5wcia2
    automated match to d2giva1
    complexed with 1vu, cl, edo, zn

Details for d5wcia1

PDB Entry: 5wci (more details), 1.78 Å

PDB Description: human myst histone acetyltransferase 1
PDB Compounds: (A:) Histone acetyltransferase KAT8

SCOPe Domain Sequences for d5wcia1:

Sequence, based on SEQRES records: (download)

>d5wcia1 d.108.1.1 (A:174-449) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]}
tkvkyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwr
qppgkeiyrksnisvhevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdr
qgahivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekpl
sdlgklsyrsywswvllenlrdfrgtlsikdlsqmtsitqndiistlqslnmvkywkgqh
vicvtpklveehlksaqykkppitvdsvclkwappk

Sequence, based on observed residues (ATOM records): (download)

>d5wcia1 d.108.1.1 (A:174-449) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]}
tkvkyvdkihignyeidawyfspfpedygkqpklwlceyclkymkyeksyrfhlgqcqwr
qppgkeiyrksnisvhevdgkdhkiycqnlcllaklfldhktlyfdvepfvfyiltevdr
qgahivgyfskekespdgnnvaciltlppyqrrgygkfliafsyelsklestvgspekpl
sdlgklsyrsywswvllenlrdfrglsikdlsqmtsitqndiistlqslnmvkywkgqhv
icvtpklveehlksaqykppitvdsvclkwappk

SCOPe Domain Coordinates for d5wcia1:

Click to download the PDB-style file with coordinates for d5wcia1.
(The format of our PDB-style files is described here.)

Timeline for d5wcia1:

  • d5wcia1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5wcia2