Lineage for d5w7za2 (5w7z A:123-248)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2193533Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2193534Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2193902Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2193903Protein automated matches [226907] (19 species)
    not a true protein
  7. 2293804Species Rickettsia conorii [TaxId:272944] [337105] (1 PDB entry)
  8. 2293806Domain d5w7za2: 5w7z A:123-248 [337107]
    Other proteins in same PDB: d5w7za4, d5w7zb4
    automated match to d1ok7a2
    complexed with edo, mrd

Details for d5w7za2

PDB Entry: 5w7z (more details), 1.7 Å

PDB Description: crystal structure of dna polymerase iii subunit beta from rickettsia conorii
PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d5w7za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w7za2 d.131.1.0 (A:123-248) automated matches {Rickettsia conorii [TaxId: 272944]}
npeasfkisctdfakiiestkfsisldetrynlngvylhikdkefcsastdghrlsiswv
tlekqiknfgvilpqksaeeilkivkdpkninedieillssnkikficnentsmlsklid
gtfpdy

SCOPe Domain Coordinates for d5w7za2:

Click to download the PDB-style file with coordinates for d5w7za2.
(The format of our PDB-style files is described here.)

Timeline for d5w7za2:

  • d5w7za2 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27