SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5w7za1 (5w7z A:1-122)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2193533Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2193534Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2193902Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2193903Protein automated matches [226907] (17 species)
    not a true protein
  7. 2293804Species Rickettsia conorii [TaxId:272944] [337105] (1 PDB entry)
  8. 2293805Domain d5w7za1: 5w7z A:1-122 [337106]
    Other proteins in same PDB: d5w7za4, d5w7zb4
    automated match to d1ok7a1
    complexed with edo, mrd

Details for d5w7za1

PDB Entry: 5w7z (more details), 1.7 Å

PDB Description: crystal structure of dna polymerase iii subunit beta from rickettsia conorii
PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d5w7za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w7za1 d.131.1.0 (A:1-122) automated matches {Rickettsia conorii [TaxId: 272944]}
mlklivetktlvqslgfassvvekrnvipeyaniklsakdgnlelsstnmdlylsqkiav
qvvsegectvstktlndivrklpdseltltdlgttgleikgknckfnlftlpvssfpamd
si

SCOPe Domain Coordinates for d5w7za1:

Click to download the PDB-style file with coordinates for d5w7za1.
(The format of our PDB-style files is described here.)

Timeline for d5w7za1:

  • d5w7za1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27