SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u6bc_ (5u6b C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (813 PDB entries)
  8. 2293803Domain d5u6bc_: 5u6b C: [337104]
    Other proteins in same PDB: d5u6bb2, d5u6bd2
    automated match to d4v04b_
    complexed with 7ys

Details for d5u6bc_

PDB Entry: 5u6b (more details), 2.84 Å

PDB Description: structure of the axl kinase domain in complex with a macrocyclic inhibitor
PDB Compounds: (C:) tyrosine-protein kinase receptor ufo

SCOPe Domain Sequences for d5u6bc_:

Sequence, based on SEQRES records: (download)

>d5u6bc_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elkeklrdvmvdrhkvalgktlgegefgavmegqlnqddsilkvavktmkiaictrsele
dflseavcmkefdhpnvmrligvcfqgseresfpapvvilpfmkhgdlhsfllysrlgdq
pvylptqmlvkfmadiasgmeylstkrfihrdlaarncmlnenmsvcvadfglskkiyng
dyyrqgriakmpvkwiaiesladrvytsksdvwsfgvtmweiatrgqtpypgvenseiyd
ylrqgnrlkqpadcldglyalmsrcwelnpqdrpsftelredlentlkalppa

Sequence, based on observed residues (ATOM records): (download)

>d5u6bc_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elkeklrdvmvdrhkvalgktlgegefgavmegqlnqddsilkvavktmkiaictrsele
dflseavcmkefdhpnvmrligvcfqpapvvilpfmkhgdlhsfllysrlgdqpvylptq
mlvkfmadiasgmeylstkrfihrdlaarncmlnenmsvcvadfglskpvkwiaieslad
rvytsksdvwsfgvtmweiatrgqtpypgvenseiydylrqgnrlkqpadcldglyalms
rcwelnpqdrpsftelredlentlkalppa

SCOPe Domain Coordinates for d5u6bc_:

Click to download the PDB-style file with coordinates for d5u6bc_.
(The format of our PDB-style files is described here.)

Timeline for d5u6bc_:

  • d5u6bc_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27