SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vd6a_ (5vd6 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2187566Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 protein domains)
  6. 2187847Protein Putative acetyltransferase PA4794 [143700] (1 species)
  7. 2187848Species Pseudomonas aeruginosa [TaxId:287] [143701] (22 PDB entries)
    Uniprot Q9HV14 1-160
  8. 2293802Domain d5vd6a_: 5vd6 A: [337103]
    automated match to d4m3sa_
    complexed with 93p, so4

Details for d5vd6a_

PDB Entry: 5vd6 (more details), 1.2 Å

PDB Description: crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with bisubstrate analog 6
PDB Compounds: (A:) acetyltransferase PA4794

SCOPe Domain Sequences for d5vd6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vd6a_ d.108.1.1 (A:) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]}
mqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdgq
vlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfna
naaglllytqlgyqpraiaerhdpdgrrvaliqmdkplep

SCOPe Domain Coordinates for d5vd6a_:

Click to download the PDB-style file with coordinates for d5vd6a_.
(The format of our PDB-style files is described here.)

Timeline for d5vd6a_:

  • d5vd6a_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27