Lineage for d5vq3a_ (5vq3 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143391Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 protein domains)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2143392Protein Nitrogenase iron-molybdenum protein, alpha chain [81402] (3 species)
  7. 2143423Species Clostridium pasteurianum [TaxId:1501] [81396] (4 PDB entries)
  8. 2293801Domain d5vq3a_: 5vq3 A: [337102]
    Other proteins in same PDB: d5vq3b_, d5vq3d_
    automated match to d1mioa_
    complexed with clf, fe2, hca, ics

Details for d5vq3a_

PDB Entry: 5vq3 (more details), 1.72 Å

PDB Description: nitrogenase cp1 at ph 6.5
PDB Compounds: (A:) nitrogenase molybdenum-iron protein alpha chain

SCOPe Domain Sequences for d5vq3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vq3a_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Clostridium pasteurianum [TaxId: 1501]}
nlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgvvm
gpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvnkl
kdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvsqs
aghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatltgd
atyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmakcf
ddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvdsl
vagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkagvp
lssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskqlhs
ydyngpyagfrgvvnfghelvngiytpawkmitppwk

SCOPe Domain Coordinates for d5vq3a_:

Click to download the PDB-style file with coordinates for d5vq3a_.
(The format of our PDB-style files is described here.)

Timeline for d5vq3a_:

  • d5vq3a_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27