SCOP 1.55: Domain d4bdpa1: 4bdp A:297-468

Lineage for d4bdpa1 (4bdp A:297-468)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (6 families)

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)

7. Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (4 PDB entries)

8. Domain d4bdpa1: 4bdp A:297-468 [33710]
   Other proteins in same PDB: d4bdpa2

Details for d4bdpa1

PDB Entry: 4bdp, 1.8 Å

PDB Description: crystal structure of bacillus dna polymerase i fragment complexed to 11 base pairs of duplex dna after addition of two datp residues

SCOP Domain Sequences for d4bdpa1:

Sequence; same for both SEQRES and ATOM records:

>d4bdpa1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
aamaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvraaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d4bdpa1:

• d4bdpa1 appears in SCOP 1.57
  
• d4bdpa1 appears in the current release, SCOPe 2.08