SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5obea_ (5obe A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2155703Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2155704Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2155705Family d.5.1.1: Ribonuclease A-like [54077] (9 protein domains)
  6. 2155814Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 2155815Species Cow (Bos taurus) [TaxId:9913] [54079] (187 PDB entries)
  8. 2293797Domain d5obea_: 5obe A: [337098]
    automated match to d1kf3a_
    complexed with 9q8, po4, ru2

Details for d5obea_

PDB Entry: 5obe (more details), 1.82 Å

PDB Description: x-ray structure of the adduct formed upon reaction of ribonuclease a with the compound fac-[ruii(co)3cl2(n3-mbi), mbi=methyl-benzimidazole
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d5obea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5obea_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d5obea_:

Click to download the PDB-style file with coordinates for d5obea_.
(The format of our PDB-style files is described here.)

Timeline for d5obea_:

  • d5obea_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27