SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v60a_ (5v60 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2198144Protein automated matches [190091] (15 species)
    not a true protein
  7. 2198237Species Human (Homo sapiens) [TaxId:9606] [188447] (623 PDB entries)
  8. 2293789Domain d5v60a_: 5v60 A: [337090]
    automated match to d3sa0a_
    complexed with acp, gol, mg

Details for d5v60a_

PDB Entry: 5v60 (more details), 2.18 Å

PDB Description: phospho-erk2 bound to amp-pcp
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d5v60a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v60a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtl
reikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyf
lyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyva
trwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsq
edlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqala
hpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpgy

SCOPe Domain Coordinates for d5v60a_:

Click to download the PDB-style file with coordinates for d5v60a_.
(The format of our PDB-style files is described here.)

Timeline for d5v60a_:

  • d5v60a_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27