Lineage for d5vdba_ (5vdb A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2187566Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 protein domains)
  6. 2187847Protein Putative acetyltransferase PA4794 [143700] (1 species)
  7. 2187848Species Pseudomonas aeruginosa [TaxId:287] [143701] (22 PDB entries)
    Uniprot Q9HV14 1-160
  8. 2293788Domain d5vdba_: 5vdb A: [337089]
    automated match to d4m3sa_
    complexed with 93m, so4

Details for d5vdba_

PDB Entry: 5vdb (more details), 1.4 Å

PDB Description: crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with bisubstrate analog 3
PDB Compounds: (A:) acetyltransferase PA4794

SCOPe Domain Sequences for d5vdba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vdba_ d.108.1.1 (A:) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]}
mqlshrpaetgdletvagfpqdrdelfycypkaiwpfsvaqlaaaiaerrgstvavhdgq
vlgfanfyqwqhgdfcalgnmmvapaarglgvaryligvmenlareqykarlmkiscfna
naaglllytqlgyqpraiaerhdpdgrrvaliqmdkple

SCOPe Domain Coordinates for d5vdba_:

Click to download the PDB-style file with coordinates for d5vdba_.
(The format of our PDB-style files is described here.)

Timeline for d5vdba_:

  • d5vdba_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27