Lineage for d5n9xb_ (5n9x B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222620Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. 2222621Protein automated matches [191083] (22 species)
    not a true protein
  7. 2222726Species Streptomyces sp. [TaxId:1931] [256140] (7 PDB entries)
  8. 2293787Domain d5n9xb_: 5n9x B: [337088]
    automated match to d3dhva_
    complexed with 8qn, atp, mg, thr

Details for d5n9xb_

PDB Entry: 5n9x (more details), 2.4 Å

PDB Description: structure of adenylation domain thr1 involved in the biosynthesis of 4-chlorothreonine in streptomyces sp.oh-5093, ligand bound structure
PDB Compounds: (B:) adenylation domain

SCOPe Domain Sequences for d5n9xb_:

Sequence, based on SEQRES records: (download)

>d5n9xb_ e.23.1.0 (B:) automated matches {Streptomyces sp. [TaxId: 1931]}
fgatlvdlfsraamempdrtalhiddekisygllhswaegladllhdagvrkgdrvalrm
ppganaiaamlgilragaayvpldirnpparnafivtdsqvvalvgdpgdipeytgplvt
eenvaalrdreaikdpgperpgpqdvayiiytsgttgrpkgvpvrhgnvtalfeacsrlf
sfsaddrwllfhsmafdfsvweiwgalstgaelvvlpywtartpvetarvvrdrgitvln
qtptafgalttavlgegidlpelryvvfggekltpavvrpwakrfgldrphlinmygite
ttvhatfhrlteddlaaedsvigrplpgfthrivtedgrdaatgepgelwlagpqvsegy
lnrpeltaerfttgpardggapppryyhsgdlvsrraggdlvyqgradlqvklrghriel
sdveaavrthpavvdavvwvhefapgdsrlvcaytaqaseegtgpdaralrahvktvlps
ymqpsqylalpelprtingkadrasvarafderr

Sequence, based on observed residues (ATOM records): (download)

>d5n9xb_ e.23.1.0 (B:) automated matches {Streptomyces sp. [TaxId: 1931]}
fgatlvdlfsraamempdrtalhiddekisygllhswaegladllhdagvrkgdrvalrm
ppganaiaamlgilragaayvpldirnpparnafivtdsqvvalvgdptgplvteenvaa
lrdregperpgpqdvayiiytsgttgrpkgvpvrhgnvtalfeacsrlfsfsaddrwllf
hsmafdfsvweiwgalstgaelvvlptartpvetarvvrdrgitvlnqtptafgalttav
lgegidlpelryvvfggekltpavvrpwakrfgldrphlinmygitettvhatfhrlted
dlaaedsvigrplpgfthrivtedgrdaatgepgelwlagpqvsegylnrpeltaerftt
gppryyhsgdlvsrraggdlvyqgradlqvklrghrielsdveaavrthpavvdavvwvh
efapgdsrlvcaytaqadaralrahvktvlpsymqpsqylalpelprtingkadrasvar
afderr

SCOPe Domain Coordinates for d5n9xb_:

Click to download the PDB-style file with coordinates for d5n9xb_.
(The format of our PDB-style files is described here.)

Timeline for d5n9xb_:

  • d5n9xb_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27