Lineage for d5u6bb1 (5u6b B:514-811)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (842 PDB entries)
  8. 2293785Domain d5u6bb1: 5u6b B:514-811 [337086]
    Other proteins in same PDB: d5u6bb2, d5u6bd2
    automated match to d4v04b_
    complexed with 7ys

Details for d5u6bb1

PDB Entry: 5u6b (more details), 2.84 Å

PDB Description: structure of the axl kinase domain in complex with a macrocyclic inhibitor
PDB Compounds: (B:) tyrosine-protein kinase receptor ufo

SCOPe Domain Sequences for d5u6bb1:

Sequence, based on SEQRES records: (download)

>d5u6bb1 d.144.1.0 (B:514-811) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nslgiseelkeklrdvmvdrhkvalgktlgegefgavmegqlnqddsilkvavktmkiai
ctrseledflseavcmkefdhpnvmrligvcfqgseresfpapvvilpfmkhgdlhsfll
ysrlgdqpvylptqmlvkfmadiasgmeylstkrfihrdlaarncmlnenmsvcvadfgl
skkiyngdyyrqgriakmpvkwiaiesladrvytsksdvwsfgvtmweiatrgqtpypgv
enseiydylrqgnrlkqpadcldglyalmsrcwelnpqdrpsftelredlentlkalp

Sequence, based on observed residues (ATOM records): (download)

>d5u6bb1 d.144.1.0 (B:514-811) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nslgiseelkeklrdvmvdrhkvalgktlgegefgavmegqlnqsilkvavktmkiaict
rseledflseavcmkefdhpnvmrligvcfresfpapvvilpfmkhgdlhsfllysrlgd
qpvylptqmlvkfmadiasgmeylstkrfihrdlaarncmlnenmsvcvadfglskkiyn
gdyyriakmpvkwiaiesladrvytsksdvwsfgvtmweiatrgqtpypgvenseiydyl
rqgnrlkqpadcldglyalmsrcwelnpqdrpsftelredlentlkalp

SCOPe Domain Coordinates for d5u6bb1:

Click to download the PDB-style file with coordinates for d5u6bb1.
(The format of our PDB-style files is described here.)

Timeline for d5u6bb1:

  • d5u6bb1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27