SCOPe 2.08: Domain d5o2tb1: 5o2t B:23-160

Lineage for d5o2tb1 (5o2t B:23-160)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries)

8. Domain d5o2tb1: 5o2t B:23-160 [337084]
   Other proteins in same PDB: d5o2ta_, d5o2tb2
   automated match to d4drxe_
   complexed with gsp, mg, so4
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d5o2tb1

PDB Entry: 5o2t, 2.19 Å

PDB Description: human kras in complex with darpin k27

PDB Compounds: (B:) darpin 55

SCOPe Domain Sequences for d5o2tb1:

Sequence; same for both SEQRES and ATOM records:

>d5o2tb1 d.211.1.1 (B:23-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlgkklleaaragqddevrilmangadvnandsaghtplhlaakrghleivevllkhgad
vnamdntgftplhlaalrghleivevllkngadvnaqdrtgrtplhlaaklghleivevl
lkngadvnaqdkfgktaf

Timeline for d5o2tb1:

• d5o2tb1 first appeared in SCOPe 2.06
  
• d5o2tb1 appears in SCOPe 2.07