SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5o2tb1 (5o2t B:23-160)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212741Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2212742Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2212743Family d.211.1.1: Ankyrin repeat [48404] (19 protein domains)
  6. 2212835Protein automated matches [190101] (7 species)
    not a true protein
  7. 2212857Species Human (Homo sapiens) [TaxId:9606] [187689] (8 PDB entries)
  8. 2293783Domain d5o2tb1: 5o2t B:23-160 [337084]
    Other proteins in same PDB: d5o2ta_, d5o2tb2
    automated match to d4drxe_
    complexed with gsp, mg, so4

Details for d5o2tb1

PDB Entry: 5o2t (more details), 2.19 Å

PDB Description: human kras in complex with darpin k27
PDB Compounds: (B:) darpin 55

SCOPe Domain Sequences for d5o2tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o2tb1 d.211.1.1 (B:23-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlgkklleaaragqddevrilmangadvnandsaghtplhlaakrghleivevllkhgad
vnamdntgftplhlaalrghleivevllkngadvnaqdrtgrtplhlaaklghleivevl
lkngadvnaqdkfgktaf

SCOPe Domain Coordinates for d5o2tb1:

Click to download the PDB-style file with coordinates for d5o2tb1.
(The format of our PDB-style files is described here.)

Timeline for d5o2tb1:

  • d5o2tb1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5o2tb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5o2ta_