Lineage for d5o2tb1 (5o2t B:23-160)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006504Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 3006505Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 3006506Family d.211.1.1: Ankyrin repeat [48404] (21 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 3006604Protein automated matches [190101] (7 species)
    not a true protein
  7. 3006626Species Human (Homo sapiens) [TaxId:9606] [187689] (13 PDB entries)
  8. 3006642Domain d5o2tb1: 5o2t B:23-160 [337084]
    Other proteins in same PDB: d5o2ta_, d5o2tb2
    automated match to d4drxe_
    complexed with gsp, mg, so4

    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d5o2tb1

PDB Entry: 5o2t (more details), 2.19 Å

PDB Description: human kras in complex with darpin k27
PDB Compounds: (B:) darpin 55

SCOPe Domain Sequences for d5o2tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o2tb1 d.211.1.1 (B:23-160) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlgkklleaaragqddevrilmangadvnandsaghtplhlaakrghleivevllkhgad
vnamdntgftplhlaalrghleivevllkngadvnaqdrtgrtplhlaaklghleivevl
lkngadvnaqdkfgktaf

SCOPe Domain Coordinates for d5o2tb1:

Click to download the PDB-style file with coordinates for d5o2tb1.
(The format of our PDB-style files is described here.)

Timeline for d5o2tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5o2tb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5o2ta_