SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v49a2 (5v49 A:607-766)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991849Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1991850Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1991903Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 1991904Protein automated matches [226872] (8 species)
    not a true protein
  7. 1991925Species Trypanosoma brucei [TaxId:999953] [226468] (26 PDB entries)
  8. 2293782Domain d5v49a2: 5v49 A:607-766 [337083]
    Other proteins in same PDB: d5v49a1, d5v49b1, d5v49b3
    automated match to d4eg8b2
    protein/RNA complex; complexed with 8wa, gol, met

Details for d5v49a2

PDB Entry: 5v49 (more details), 2.3 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with inhibitor (chem 1917)
PDB Compounds: (A:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d5v49a2:

Sequence, based on SEQRES records: (download)

>d5v49a2 a.27.1.0 (A:607-766) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrs

Sequence, based on observed residues (ATOM records): (download)

>d5v49a2 a.27.1.0 (A:607-766) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavevlfskrs

SCOPe Domain Coordinates for d5v49a2:

Click to download the PDB-style file with coordinates for d5v49a2.
(The format of our PDB-style files is described here.)

Timeline for d5v49a2:

  • d5v49a2 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27