SCOP 1.59: Domain d1xwl_1: 1xwl 297-468

Lineage for d1xwl_1 (1xwl 297-468)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)

7. Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (4 PDB entries)

8. Domain d1xwl_1: 1xwl 297-468 [33708]
   Other proteins in same PDB: d1xwl_2

Details for d1xwl_1

PDB Entry: 1xwl, 1.7 Å

PDB Description: bacillus stearothermophilus (newly identified strain as yet unnamed) dna polymerase fragment

SCOP Domain Sequences for d1xwl_1:

Sequence; same for both SEQRES and ATOM records:

>d1xwl_1 c.55.3.5 (297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d1xwl_1:

• d1xwl_1 first appeared (with stable ids) in SCOP 1.55
  
• d1xwl_1 appears in SCOP 1.57
  
• d1xwl_1 appears in SCOP 1.61
  
• d1xwl_1 appears in the current release, SCOPe 2.08, called d1xwla1