Lineage for d1xwl_1 (1xwl 297-468)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 71788Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 72015Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 72183Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)
  6. 72206Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
  7. 72207Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (4 PDB entries)
  8. 72208Domain d1xwl_1: 1xwl 297-468 [33708]
    Other proteins in same PDB: d1xwl_2

Details for d1xwl_1

PDB Entry: 1xwl (more details), 1.7 Å

PDB Description: bacillus stearothermophilus (newly identified strain as yet unnamed) dna polymerase fragment

SCOP Domain Sequences for d1xwl_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xwl_1 c.55.3.5 (297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOP Domain Coordinates for d1xwl_1:

Click to download the PDB-style file with coordinates for d1xwl_1.
(The format of our PDB-style files is described here.)

Timeline for d1xwl_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xwl_2