SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v49b1 (5v49 B:237-606)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (46 species)
    not a true protein
  7. 2106228Species Trypanosoma brucei [TaxId:999953] [226467] (26 PDB entries)
  8. 2293778Domain d5v49b1: 5v49 B:237-606 [337079]
    Other proteins in same PDB: d5v49a2, d5v49b2, d5v49b3
    automated match to d4eg8b1
    protein/RNA complex; complexed with 8wa, gol, met

Details for d5v49b1

PDB Entry: 5v49 (more details), 2.3 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with inhibitor (chem 1917)
PDB Compounds: (B:) Methionyl-tRNA synthetase, putative

SCOPe Domain Sequences for d5v49b1:

Sequence, based on SEQRES records: (download)

>d5v49b1 c.26.1.0 (B:237-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
kvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaea
akqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiyl
gryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerl
lewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwld
altnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsagl
plpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdk
nmiarlngel

Sequence, based on observed residues (ATOM records): (download)

>d5v49b1 c.26.1.0 (B:237-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
kvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaea
akqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiyl
gryegwysisdesfltpqnitdgvdnpckvslesghvvtwvseenymfrlsafrerllew
yhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwldalt
nyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglplp
kkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdknmi
arlngel

SCOPe Domain Coordinates for d5v49b1:

Click to download the PDB-style file with coordinates for d5v49b1.
(The format of our PDB-style files is described here.)

Timeline for d5v49b1:

  • d5v49b1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27