SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gn6d1 (5gn6 D:1-262)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2123183Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2123184Protein automated matches [226839] (52 species)
    not a true protein
  7. 2123637Species Trypanosoma brucei [TaxId:31285] [268052] (8 PDB entries)
  8. 2293775Domain d5gn6d1: 5gn6 D:1-262 [337076]
    Other proteins in same PDB: d5gn6a3, d5gn6b3, d5gn6c3, d5gn6d3
    automated match to d3wxla1
    complexed with 6y0, gol

Details for d5gn6d1

PDB Entry: 5gn6 (more details), 2.5 Å

PDB Description: crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with cumarin derivative-17b
PDB Compounds: (D:) glycerol kinase

SCOPe Domain Sequences for d5gn6d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gn6d1 c.55.1.0 (D:1-262) automated matches {Trypanosoma brucei [TaxId: 31285]}
mkyvgsidqgttstrfiifderqrpvsvhqvphtqhtphpgwlehdpmeifrsackcmsv
aiaklrqkdasfrkieaigitnqrettvawdrvtkeplcyapvwndlrtyditkkvtael
gggdsmfaskitglpvstyfaafkmrwmlenvpavadacrrgtlcfgtidtwlmyklsgg
kafvtdvtnasrtflmdlrtrkwspelceklkipmetlpeirsnselfgyvetdecgvaa
alnertpimgsigdqqsalfgn

SCOPe Domain Coordinates for d5gn6d1:

Click to download the PDB-style file with coordinates for d5gn6d1.
(The format of our PDB-style files is described here.)

Timeline for d5gn6d1:

  • d5gn6d1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27