SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4glia_ (4gli A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (136 species)
    not a true protein
  7. 2145835Species Human (Homo sapiens) [TaxId:9606] [193730] (29 PDB entries)
  8. 2293771Domain d4glia_: 4gli A: [337072]
    automated match to d2ghba_

Details for d4glia_

PDB Entry: 4gli (more details), 1.9 Å

PDB Description: crystal structure of human smn yg-dimer
PDB Compounds: (A:) Maltose-binding periplasmic protein, Survival motor neuron protein chimera

SCOPe Domain Sequences for d4glia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4glia_ c.94.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
lkdaqtritmliswymsgyhtgyymgfr

SCOPe Domain Coordinates for d4glia_:

Click to download the PDB-style file with coordinates for d4glia_.
(The format of our PDB-style files is described here.)

Timeline for d4glia_:

  • d4glia_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27