SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ntta1 (5ntt A:519-797)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (813 PDB entries)
  8. 2293769Domain d5ntta1: 5ntt A:519-797 [337070]
    Other proteins in same PDB: d5ntta2
    automated match to d3dbqa_
    complexed with edo, sve; mutant

Details for d5ntta1

PDB Entry: 5ntt (more details), 2.75 Å

PDB Description: crystal structure of human mps1 (ttk) c604y mutant in complex with nms-p715
PDB Compounds: (A:) Dual specificity protein kinase TTK

SCOPe Domain Sequences for d5ntta1:

Sequence, based on SEQRES records: (download)

>d5ntta1 d.144.1.0 (A:519-797) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkgriysilkqigsggsskvfqvlnekkqiyaikyvnleeadnqtldsyrneiaylnkl
qqhsdkiirlydyeitdqyiymvmeygnidlnswlkkkksidpwerksywknmleavhti
hqhgivhsdlkpanflivdgmlklidfgianqmqpdttsvvkdsqvgtvnymppeaikdm
sssrengkskskispksdvwslgcilyymtygktpfqqiinqisklhaiidpnheiefpd
ipekdlqdvlkcclkrdpkqrisipellahpyvqiqthp

Sequence, based on observed residues (ATOM records): (download)

>d5ntta1 d.144.1.0 (A:519-797) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkgriysilkqigsggsskvfqvlnekkqiyaikyvnleeadnqtldsyrneiaylnkl
qqhsdkiirlydyeitdqyiymvmeygnidlnswlkkkksidpwerksywknmleavhti
hqhgivhsdlkpanflivdgmlklidfgianqmqpdttsvvkdsqvgtvnymppeaikdm
skispksdvwslgcilyymtygktpfqqiinqisklhaiidpnheiefpdipekdlqdvl
kcclkrdpkqrisipellahpyvqiqthp

SCOPe Domain Coordinates for d5ntta1:

Click to download the PDB-style file with coordinates for d5ntta1.
(The format of our PDB-style files is described here.)

Timeline for d5ntta1:

  • d5ntta1 appears in periodic updates to SCOPe 2.06 starting on 2017-07-27

View in 3D
Domains from same chain:
(mouse over for more information)
d5ntta2