Lineage for d1taua3 (1tau A:290-422)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124495Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
  5. 124680Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)
  6. 124703Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
  7. 124724Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries)
  8. 124737Domain d1taua3: 1tau A:290-422 [33707]
    Other proteins in same PDB: d1taua1, d1taua2, d1taua4

Details for d1taua3

PDB Entry: 1tau (more details), 3 Å

PDB Description: taq polymerase (e.c.2.7.7.7)/dna/b-octylglucoside complex

SCOP Domain Sequences for d1taua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1taua3 c.55.3.5 (A:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus}
spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
erlfanlwgrleg

SCOP Domain Coordinates for d1taua3:

Click to download the PDB-style file with coordinates for d1taua3.
(The format of our PDB-style files is described here.)

Timeline for d1taua3: