![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) ![]() |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins) |
![]() | Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) |
![]() | Species Thermus aquaticus [TaxId:271] [53121] (13 PDB entries) |
![]() | Domain d1taua3: 1tau A:290-422 [33707] Other proteins in same PDB: d1taua1, d1taua2, d1taua4 |
PDB Entry: 1tau (more details), 3 Å
SCOP Domain Sequences for d1taua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1taua3 c.55.3.5 (A:290-422) Exonuclease domain of prokaryotic DNA polymerase {Thermus aquaticus} spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals erlfanlwgrleg
Timeline for d1taua3: