Lineage for d5nvke_ (5nvk E:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182898Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2182899Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2182952Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2182953Protein automated matches [190708] (8 species)
    not a true protein
  7. 2182969Species Human (Homo sapiens) [TaxId:9606] [187914] (7 PDB entries)
  8. 2293768Domain d5nvke_: 5nvk E: [337069]
    Other proteins in same PDB: d5nvkg2
    automated match to d2jgba_

Details for d5nvke_

PDB Entry: 5nvk (more details), 2.9 Å

PDB Description: crystal structure of the human 4ehp-gigyf1 complex
PDB Compounds: (E:) eukaryotic translation initiation factor 4e type 2

SCOPe Domain Sequences for d5nvke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nvke_ d.86.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aehplqynytfwysrrtpgrptssqsyeqnikqigtfasveqfwrfyshmvrpgdltghs
dfhlfkegikpmweddanknggkwiirlrkglasrcwenlilamlgeqfmvgeeicgavv
svrfqediisiwnktasdqattarirdtlrrvlnlppntimeykthtd

SCOPe Domain Coordinates for d5nvke_:

Click to download the PDB-style file with coordinates for d5nvke_.
(The format of our PDB-style files is described here.)

Timeline for d5nvke_:

  • d5nvke_ appears in periodic updates to SCOPe 2.06 starting on 2017-07-27