Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d5tudb2: 5tud B:106-211 [337068] Other proteins in same PDB: d5tudb1, d5tudc1, d5tudc2, d5tude1, d5tudf1, d5tudf2 automated match to d1dn0a2 complexed with erm |
PDB Entry: 5tud (more details), 3 Å
SCOPe Domain Sequences for d5tudb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tudb2 b.1.1.2 (B:106-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglslpvtksfnrg
Timeline for d5tudb2: