Lineage for d5szfl2 (5szf L:108-212)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2030162Domain d5szfl2: 5szf L:108-212 [337065]
    Other proteins in same PDB: d5szfl1
    automated match to d1p7kl2
    complexed with so4

Details for d5szfl2

PDB Entry: 5szf (more details), 2.52 Å

PDB Description: 2a10 fab fragment 2.54 angstoms
PDB Compounds: (L:) 2A10 antibody FAB fragment light chain

SCOPe Domain Sequences for d5szfl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5szfl2 b.1.1.2 (L:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d5szfl2:

Click to download the PDB-style file with coordinates for d5szfl2.
(The format of our PDB-style files is described here.)

Timeline for d5szfl2: